Recombinant Human ACE2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BYF1

Gene Name: ACE2

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Ile21

End Site: Glu160

Coverage: 0.17

Isoelectric Point: 4.5

Core Sequence: IEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 76%, Pig - 74%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Angiotensin-converting enzyme 2; Angiotensin-converting enzyme homolog; ACEH; Angiotensin-converting enzyme-related carboxypeptidase; ACE-related carboxypeptidase; Metalloprotease MPROT15) [Cleaved into: Processed angiotensin-converting enzyme 2]

Protein name: angiotensin converting enzyme 2

Full length: 805 amino acids

Entry name: ACE2_HUMAN

Product panel: Enzyme

• SKU: ASBPP-376-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-376-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 59272