Recombinant Human ACSL6 Protein

Recombinant Human ACSL6 Protein
SKU
ASBPP-3790-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UKU0

Gene Name: ACSL6

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Lys521

End Site: Glu690

Coverage: 0.25

Isoelectric Point: 8

Core Sequence: KDPDRTKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLCTNKDLKKAILEDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 92%

Alternative gene names: ACS2; FACL6; KIAA0837; LACS5

Alternative protein names: Long-chain-fatty-acid--CoA ligase 6; Arachidonate--CoA ligase; Long-chain acyl-CoA synthetase 6; LACS 6

Protein name: acyl-CoA synthetase long chain family member 6

Full length: 697 amino acids

Entry name: ACSL6_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3790-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3790-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 23305
Product information (PDF)
×
MSDS (PDF)
×