Recombinant Human ACTL6B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O94805

Gene Name: ACTL6B

Expression System: Escherichia coli

Molecular Weight: 48 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Val11

End Site: Cys420

Coverage: 0.99

Isoelectric Point: 6

Core Sequence: VGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%

Alternative gene names: ACTL6; BAF53B

Alternative protein names: Actin-like protein 6B; 53 kDa BRG1-associated factor B; Actin-related protein Baf53b; ArpNalpha; BRG1-associated factor 53B; BAF53B

Protein name: actin like 6B

Full length: 426 amino acids

Entry name: ACL6B_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3782-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3782-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 51412