Recombinant Human ADCY7 Protein

Recombinant Human ADCY7 Protein
SKU
ASBPP-3183-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P51828

Gene Name: ADCY7

Expression System: Escherichia coli

Molecular Weight: 28 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Met841

End Site: Asp1070

Coverage: 0.22

Isoelectric Point: 6

Core Sequence: MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVASGHENQELERQHAHIGVMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 78%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: KIAA0037

Alternative protein names: Adenylate cyclase type 7; ATP pyrophosphate-lyase 7; Adenylate cyclase type VII; Adenylyl cyclase 7

Protein name: adenylate cyclase 7

Full length: 1080 amino acids

Entry name: ADCY7_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3183-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3183-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 113
Product information (PDF)
×
MSDS (PDF)
×