Recombinant Human ADM Protein

Recombinant Human ADM Protein
SKU
ASBPP-3756-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P35318

Gene Name: ADM

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Arg31

End Site: Lys140

Coverage: 0.68

Isoelectric Point: 11

Core Sequence: RKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 73%, Pig - 91%

Alternative gene names: AM

Alternative protein names: Pro-adrenomedullin [Cleaved into: Adrenomedullin; AM; Proadrenomedullin N-20 terminal peptide; ProAM N-terminal 20 peptide; PAMP; ProAM-N20]

Protein name: adrenomedullin

Full length: 185 amino acids

Entry name: ADML_HUMAN
More Information
SKU ASBPP-3756-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3756-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 133
Product information (PDF)
×
MSDS (PDF)
×