Recombinant Human ADNP2 Protein

Recombinant Human ADNP2 Protein
SKU
ASBPP-10474-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6IQ32

Gene Name: ADNP2

Expression System: Escherichia coli

Molecular Weight: 34.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Asn791

End Site: Phe1080

Coverage: 0.26

Isoelectric Point: 9

Core Sequence: NRHLGKKKLPMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKLGEREVYLAILAGIHSKSLVPVYVKVRPQAEGTPGSTGKRVSTCPFCFGPFVTTEAYELHLKERHHIMPTVHTVLKSPAFKCIHCCGVYTGNMTLAAIAVHLVRCRSAPKDSSSDLQAQPGFIHNSELLLVSGEVMHDSSFSVKRKLPDGHLGAEDQRHGEEQPPILNADAAPGPEKVTSVVPFKRQRNESRTEGPIVKDEALQILALDPKKYEGRSYEEKKQFLKDYFHKKPYPSKKEIELLSSLF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 36%, Pig - 86%, Cynomolgus monkey - 98%

Alternative gene names: KIAA0863; ZNF508

Alternative protein names: Activity-dependent neuroprotector homeobox protein 2; ADNP homeobox protein 2; Zinc finger protein 508

Protein name: ADNP homeobox 2

Full length: 1131 amino acids

Entry name: ADNP2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10474-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10474-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 22850
Product information (PDF)
×
MSDS (PDF)
×