Recombinant Human ADRA2C Protein

Recombinant Human ADRA2C Protein
SKU
ASBPP-4390-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P18825

Gene Name: ADRA2C

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Thr241

End Site: Arg370

Coverage: 0.32

Isoelectric Point: 12

Core Sequence: TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGALRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRRRRARSSVCRR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 84%, Pig - 83%

Alternative gene names: ADRA2L2; ADRA2RL2

Alternative protein names: Alpha-2C adrenergic receptor; Alpha-2 adrenergic receptor subtype C4; Alpha-2C adrenoreceptor; Alpha-2C adrenoceptor; Alpha-2CAR

Protein name: adrenoceptor alpha 2C

Full length: 462 amino acids

Entry name: ADA2C_HUMAN

Product panel: Neuroscience Biomarkers
More Information
SKU ASBPP-4390-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4390-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 152
Product information (PDF)
×
MSDS (PDF)
×