Recombinant Human AHSP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NZD4

Gene Name: AHSP

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Met1

End Site: Ser102

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Pig - 68%, Cynomolgus monkey - 94%

Alternative gene names: EDRF; ERAF

Alternative protein names: Alpha-hemoglobin-stabilizing protein; Erythroid differentiation-related factor; Erythroid-associated factor

Protein name: alpha hemoglobin stabilizing protein

Full length: 102 amino acids

Entry name: AHSP_HUMAN

• SKU: ASBPP-3905-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3905-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 51327