Recombinant Human ALDH3B1 Protein

Recombinant Human ALDH3B1 Protein
SKU
ASBPP-3820-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P43353

Gene Name: ALDH3B1

Expression System: Escherichia coli

Molecular Weight: 40.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Lys41

End Site: Asp390

Coverage: 0.76

Isoelectric Point: 6

Core Sequence: KQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSEISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSDESDRYIAPTVLVDVQEMEPVMQEEIFGPILPIVNVQSLDEAIEFINRREKPLALYAFSNSSQVVKRVLTQTSSGGFCGND

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 87%, Pig - 88%, Cynomolgus monkey - 96%

Alternative gene names: ALDH7

Alternative protein names: Aldehyde dehydrogenase family 3 member B1; Aldehyde dehydrogenase 7

Protein name: aldehyde dehydrogenase 3 family member B1

Full length: 468 amino acids

Entry name: AL3B1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3820-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3820-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 221
Product information (PDF)
×
MSDS (PDF)
×