Recombinant Human ALK Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UM73

Gene Name: ALK

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 74%

Start Site: Ile1461

End Site: Arg1530

Coverage: 0.05

Isoelectric Point: 10.5

Core Sequence: ISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 74%, Pig - 76%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: ALK tyrosine kinase receptor; Anaplastic lymphoma kinase; CD antigen CD246

Protein name: ALK receptor tyrosine kinase

Full length: 1620 amino acids

Entry name: ALK_HUMAN

CD Antigen: CD246

Product panel: IHC Pathology,CD Antigen,Enzyme

• SKU: ASBPP-428-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-428-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 238