Recombinant Human ANKRD2 Protein

Recombinant Human ANKRD2 Protein
SKU
ASBPP-4161-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9GZV1

Gene Name: ANKRD2

Expression System: Escherichia coli

Molecular Weight: 41 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Met1

End Site: Gln360

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 59%, Pig - 89%, Cynomolgus monkey - 97%

Alternative gene names: ARPP

Alternative protein names: Ankyrin repeat domain-containing protein 2; Skeletal muscle ankyrin repeat protein; hArpp

Protein name: ankyrin repeat domain 2

Full length: 360 amino acids

Entry name: ANKR2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-4161-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4161-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 26287
Product information (PDF)
×
MSDS (PDF)
×