Recombinant Human ANO10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NW15

Gene Name: ANO10

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Ser11

End Site: Ile200

Coverage: 0.31

Isoelectric Point: 7.5

Core Sequence: SESSFTPLVVIELAQDVKEETKEWLKNRIIAKKKDGGAQLLFRPLLNKYEQETLENQNLYLVGASKIRMLLGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRRLLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIDSI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Pig - 94%, Cynomolgus monkey - 98%

Alternative gene names: TMEM16K

Alternative protein names: Anoctamin-10; Transmembrane protein 16K

Protein name: anoctamin 10

Full length: 660 amino acids

Entry name: ANO10_HUMAN

• SKU: ASBPP-3807-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3807-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 55129