Recombinant Human ANO7 Protein

Recombinant Human ANO7 Protein
SKU
ASBPP-3808-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6IWH7

Gene Name: ANO7

Expression System: Escherichia coli

Molecular Weight: 32.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Gln61

End Site: Gln330

Coverage: 0.29

Isoelectric Point: 7

Core Sequence: QEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQAAACRAGSPAKPRIADFVLVWEEDLKLDRQQDSAARDRTDMHRTWRETFLDNLRAAGLCVDQQDVQDGNTTVHYALLSASWAVLCYYAEDLRLKLPLQELPNQASNWSAGLLAWLGIPNVLLEVVPDVPPEYYSCRFRVNKLPRFLGSDNQDTFFTSTKRHQILFEILAKTPYGHEKKNLLGIHQLLAEGVLSAAFPLHDGPFKTPPEGPQAPRLNQRQVLFQHWARWGKWNKYQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 73%, Pig - 34%, Cynomolgus monkey - 92%

Alternative gene names: NGEP; PCANAP5; TMEM16G

Alternative protein names: Anoctamin-7; Dresden transmembrane protein of the prostate; D-TMPP; IPCA-5; New gene expressed in prostate; Prostate cancer-associated protein 5; Transmembrane protein 16G

Protein name: anoctamin 7

Full length: 933 amino acids

Entry name: ANO7_HUMAN
More Information
SKU ASBPP-3808-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3808-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 50636
Product information (PDF)
×
MSDS (PDF)
×