Note: Dry Ice fees will be extra-charged
Uniprot: P50995
Gene Name: ANXA11
Expression System: Escherichia coli
Molecular Weight: 11.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 93%
Start Site: Asp291
End Site: Asn370
Coverage: 0.17
Isoelectric Point: 6
Core Sequence: DEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGEN
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 57%, Pig - 93%, Cynomolgus monkey - 100%
Alternative gene names: ANX11
Alternative protein names: Annexin A11; 56 kDa autoantigen; Annexin XI; Annexin-11; Calcyclin-associated annexin 50; CAP-50
Protein name: annexin A11
Full length: 505 amino acids
Entry name: ANX11_HUMAN
Product panel: Neurodegenerative Diseases Marker,Neuroscience Biomarkers
English
Deutsch
