Recombinant Human AQR Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O60306

Gene Name: AQR

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: His731

End Site: Ile800

Coverage: 0.05

Isoelectric Point: 9

Core Sequence: HNVKVTVEDPALQIPPFRITFPVRSGKGKKRKDADVEDEDTEEAKTLIVEPHVIPNRGPYPYNQPKRNTI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Pig - 98%

Alternative gene names: KIAA0560

Alternative protein names: RNA helicase aquarius; Intron-binding protein of 160 kDa; IBP160

Protein name: aquarius intron-binding spliceosomal factor

Full length: 1485 amino acids

Entry name: AQR_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3758-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3758-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 9716