Note: Dry Ice fees will be extra-charged
Uniprot: P10398
Gene Name: ARAF
Expression System: Escherichia coli
Molecular Weight: 19 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 87%
Start Site: Arg151
End Site: Gly300
Coverage: 0.27
Isoelectric Point: 9
Core Sequence: RQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSG
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 87%, Pig - 91%, Cynomolgus monkey - 98%
Alternative gene names: ARAF1; PKS; PKS2
Alternative protein names: Serine/threonine-protein kinase A-Raf; Proto-oncogene A-Raf; Proto-oncogene A-Raf-1; Proto-oncogene Pks
Protein name: A-Raf proto-oncogene, serine/threonine kinase
Full length: 606 amino acids
Entry name: ARAF_HUMAN
Product panel: Enzyme
English
Deutsch
