Recombinant Human ARAF Protein

Recombinant Human ARAF Protein
SKU
ASBPP-4370-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P10398

Gene Name: ARAF

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Arg151

End Site: Gly300

Coverage: 0.27

Isoelectric Point: 9

Core Sequence: RQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 87%, Pig - 91%, Cynomolgus monkey - 98%

Alternative gene names: ARAF1; PKS; PKS2

Alternative protein names: Serine/threonine-protein kinase A-Raf; Proto-oncogene A-Raf; Proto-oncogene A-Raf-1; Proto-oncogene Pks

Protein name: A-Raf proto-oncogene, serine/threonine kinase

Full length: 606 amino acids

Entry name: ARAF_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4370-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4370-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 369
Product information (PDF)
×
MSDS (PDF)
×