Recombinant Human ARHGDIG Protein

Recombinant Human ARHGDIG Protein
SKU
ASBPP-371-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q99819

Gene Name: ARHGDIG

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Glu31

End Site: Cys220

Coverage: 0.88

Isoelectric Point: 6.5

Core Sequence: EGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCIC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 61%, Pig - 84%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Rho GDP-dissociation inhibitor 3; Rho GDI 3; Rho-GDI gamma

Protein name: Rho GDP dissociation inhibitor gamma

Full length: 225 amino acids

Entry name: GDIR3_HUMAN
More Information
SKU ASBPP-371-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-371-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 398
Product information (PDF)
×
MSDS (PDF)
×