Recombinant Human ARPC3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O15145

Gene Name: ARPC3

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Met1

End Site: Gln178

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 100%, Cynomolgus monkey - 97%

Alternative gene names: ARC21

Alternative protein names: Actin-related protein 2/3 complex subunit 3; Arp2/3 complex 21 kDa subunit; p21-ARC

Protein name: actin related protein 2/3 complex subunit 3

Full length: 178 amino acids

Entry name: ARPC3_HUMAN

• SKU: ASBPP-3912-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3912-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 10094