Recombinant Human AS3MT Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HBK9

Gene Name: AS3MT

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Cys271

End Site: Ala350

Coverage: 0.23

Isoelectric Point: 5

Core Sequence: CQVIYNGGITGHEKELMFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 72%, Pig - 84%, Cynomolgus monkey - 99%

Alternative gene names: CYT19

Alternative protein names: Arsenite methyltransferase; Methylarsonite methyltransferase; S-adenosyl-L-methionine:arsenic(III) methyltransferase

Protein name: arsenite methyltransferase

Full length: 375 amino acids

Entry name: AS3MT_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3836-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3836-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 57412