Recombinant Human ASCL4 Protein

Recombinant Human ASCL4 Protein
SKU
ASBPP-3697-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6XD76

Gene Name: ASCL4

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Pro71

End Site: Gly170

Coverage: 0.59

Isoelectric Point: 7.5

Core Sequence: PAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLERQAWGLEGAAGAVPQRRAECNSDGESKASSAPSPSSEPEEG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Rat - 46%, Pig - 92%, Cynomolgus monkey - 93%

Alternative gene names: BHLHA44; HASH4

Alternative protein names: Achaete-scute homolog 4; ASH-4; hASH4; Achaete-scute-like protein 4; Class A basic helix-loop-helix protein 44; bHLHa44

Protein name: achaete-scute family bHLH transcription factor 4

Full length: 172 amino acids

Entry name: ASCL4_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3697-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3697-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 121549
Product information (PDF)
×
MSDS (PDF)
×