Recombinant Human ATCAY Protein

Recombinant Human ATCAY Protein
SKU
ASBPP-4139-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q86WG3

Gene Name: ATCAY

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Glu11

End Site: Met170

Coverage: 0.45

Isoelectric Point: 4

Core Sequence: ENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEINISLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETDSLEFLGNGNELEWEDDTPVATAKNMPGDSADLFGDGTTEDGSAANGRLWRTVIIGEQEHRIDLHM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 92%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1872

Alternative protein names: Caytaxin; Ataxia cayman type protein; BNIP-2-homology; BNIP-H

Protein name: ATCAY kinesin light chain interacting caytaxin

Full length: 371 amino acids

Entry name: ATCAY_HUMAN
More Information
SKU ASBPP-4139-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4139-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 85300
Product information (PDF)
×
MSDS (PDF)
×