Recombinant Human ATOH1 Protein

Recombinant Human ATOH1 Protein
SKU
ASBPP-4144-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q92858

Gene Name: ATOH1

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Glu91

End Site: Ser230

Coverage: 0.41

Isoelectric Point: 10.5

Core Sequence: EAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPAS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 60%, Pig - 94%, Cynomolgus monkey - 97%

Alternative gene names: ATH1; BHLHA14

Alternative protein names: Transcription factor ATOH1; Atonal bHLH transcription factor 1; Class A basic helix-loop-helix protein 14; bHLHa14; Helix-loop-helix protein hATH-1; hATH1; Protein atonal homolog 1

Protein name: atonal bHLH transcription factor 1

Full length: 354 amino acids

Entry name: ATOH1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-4144-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4144-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 474
Product information (PDF)
×
MSDS (PDF)
×