Recombinant Human ATP11B Protein

Recombinant Human ATP11B Protein
SKU
ASBPP-2952-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y2G3

Gene Name: ATP11B

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Glu381

End Site: Leu570

Coverage: 0.17

Isoelectric Point: 4.5

Core Sequence: EESDQKAQVNTSDLNEELGQVEYVFTDKTGTLTENEMQFRECSINGMKYQEINGRLVPEGPTPDSSEGNLSYLSSLSHLNNLSHLTTSSSFRTSPENETELIKEHDLFFKAVSLCHTVQISNVQTDCTGDGPWQSNLAPSQLEYYASSPDEKALVEAAARIGIVFIGNSEETMEVKTLGKLERYKLLHIL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 36%, Pig - 89%, Cynomolgus monkey - 100%

Alternative gene names: ATPIF; ATPIR; KIAA0956

Alternative protein names: Phospholipid-transporting ATPase IF; ATPase IR; ATPase class VI type 11B; P4-ATPase flippase complex alpha subunit ATP11B

Protein name: ATPase phospholipid transporting 11B (putative)

Full length: 1177 amino acids

Entry name: AT11B_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-2952-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2952-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 23200
Product information (PDF)
×
MSDS (PDF)
×