Note: Dry Ice fees will be extra-charged
Uniprot: P05023
Gene Name: ATP1A1
Expression System: Escherichia coli
Molecular Weight: 15.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 99%
Start Site: Phe161
End Site: Gly280
Coverage: 0.13
Isoelectric Point: 6
Core Sequence: FKNMVPQQALVIRNGEKMSINAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGG
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 99%
Alternative gene names: /
Alternative protein names: Sodium/potassium-transporting ATPase subunit alpha-1; Na(+)/K(+) ATPase alpha-1 subunit; Sodium pump subunit alpha-1
Protein name: ATPase Na+/K+ transporting subunit alpha 1
Full length: 1023 amino acids
Entry name: AT1A1_HUMAN
Product panel: Neuroscience Biomarkers,Enzyme
English
Deutsch
