Recombinant Human ATP4A Protein

Recombinant Human ATP4A Protein
SKU
ASBPP-4278-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P20648

Gene Name: ATP4A

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Ser11

End Site: Ala90

Coverage: 0.09

Isoelectric Point: 10

Core Sequence: SVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVAELEQKYQTSATKGLSASLAAELLLRDGPNA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 91%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Potassium-transporting ATPase alpha chain 1; Gastric H(+)/K(+) ATPase subunit alpha; Proton pump

Protein name: ATPase H+/K+ transporting subunit alpha

Full length: 1035 amino acids

Entry name: ATP4A_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4278-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4278-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 495
Product information (PDF)
×
MSDS (PDF)
×