Recombinant Human ATP5F1D Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P30049

Gene Name: ATP5F1D

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Ala23

End Site: Glu168

Coverage: 1.00

Isoelectric Point: 5

Core Sequence: AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 91%, Pig - 92%, Cynomolgus monkey - 97%

Alternative gene names: ATP5D

Alternative protein names: ATP synthase subunit delta; mitochondrial; ATP synthase F1 subunit delta; F-ATPase delta subunit

Protein name: ATP synthase F1 subunit delta

Full length: 168 amino acids

Entry name: ATPD_HUMAN

• SKU: ASBPP-4410-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4410-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 513