Recombinant Human ATP6V1G2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95670

Gene Name: ATP6V1G2

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Met1

End Site: Ala118

Coverage: 1.00

Isoelectric Point: 10.5

Core Sequence: MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: ATP6G; ATP6G2; NG38

Alternative protein names: V-type proton ATPase subunit G 2; V-ATPase subunit G 2; V-ATPase 13 kDa subunit 2; Vacuolar proton pump subunit G 2

Protein name: ATPase H+ transporting V1 subunit G2

Full length: 118 amino acids

Entry name: VATG2_HUMAN

• SKU: ASBPP-4180-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4180-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 534