Recombinant Human AZI2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H6S1

Gene Name: AZI2

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Thr81

End Site: Ser270

Coverage: 0.49

Isoelectric Point: 6.5

Core Sequence: TSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSTAIKKACAPVGCSEDLGRDS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 77%, Pig - 91%, Cynomolgus monkey - 99%

Alternative gene names: NAP1; TBKBP2

Alternative protein names: 5-azacytidine-induced protein 2; NF-kappa-B-activating kinase-associated protein 1; Nak-associated protein 1; Nap1; TILP

Protein name: 5-azacytidine induced 2

Full length: 392 amino acids

Entry name: AZI2_HUMAN

• SKU: ASBPP-393-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-393-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 64343