Recombinant Human BARX1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HBU1

Gene Name: BARX1

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Asp171

End Site: Pro240

Coverage: 0.33

Isoelectric Point: 10.5

Core Sequence: DRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKDAEKP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 62%, Pig - 96%

Alternative gene names: /

Alternative protein names: Homeobox protein BarH-like 1

Protein name: BARX homeobox 1

Full length: 254 amino acids

Entry name: BARX1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3771-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3771-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 56033