Recombinant Human BLVRA Protein

Recombinant Human BLVRA Protein
SKU
ASBPP-3878-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P53004

Gene Name: BLVRA

Expression System: Escherichia coli

Molecular Weight: 34.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Ala3

End Site: Lys296

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: AEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 83%, Pig - 91%, Cynomolgus monkey - 100%

Alternative gene names: BLVR; BVR

Alternative protein names: Biliverdin reductase A; BVR A; Biliverdin-IX alpha-reductase

Protein name: biliverdin reductase A

Full length: 296 amino acids

Entry name: BIEA_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3878-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3878-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 644
Product information (PDF)
×
MSDS (PDF)
×