Recombinant Human BRF2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HAW0

Gene Name: BRF2

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Thr321

End Site: Arg400

Coverage: 0.22

Isoelectric Point: 6

Core Sequence: TREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Rat - 70%, Pig - 80%

Alternative gene names: BRFU

Alternative protein names: Transcription factor IIIB 50 kDa subunit; TFIIIB50; hTFIIIB50; B-related factor 2; BRF-2; hBRFU

Protein name: BRF2 general transcription factor IIIB subunit

Full length: 419 amino acids

Entry name: BRF2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3775-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3775-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 55290