Recombinant Human BSND Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8WZ55

Gene Name: BSND

Expression System: Escherichia coli

Molecular Weight: 30.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 66%

Start Site: Thr61

End Site: Gly320

Coverage: 0.83

Isoelectric Point: 4

Core Sequence: TFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 66%, Rat - 66%, Pig - 75%, Cynomolgus monkey - 90%

Alternative gene names: BART

Alternative protein names: Barttin

Protein name: barttin CLCNK type accessory subunit beta

Full length: 320 amino acids

Entry name: BSND_HUMAN

• SKU: ASBPP-4152-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4152-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 7809