Recombinant Human C1QTNF1 Protein

Recombinant Human C1QTNF1 Protein
SKU
ASBPP-374-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BXJ1

Gene Name: C1QTNF1

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Gln31

End Site: Arg140

Coverage: 0.44

Isoelectric Point: 7

Core Sequence: QGEQQEWEGTEELPSPPDHAERAEEQHEKYRPSQDQGLPASRCLRCCDPGTSMYPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGSMGAPGER

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 72%, Pig - 80%, Cynomolgus monkey - 98%

Alternative gene names: CTRP1

Alternative protein names: Complement C1q tumor necrosis factor-related protein 1; G protein-coupled receptor-interacting protein; GIP

Protein name: C1q and TNF related 1

Full length: 281 amino acids

Entry name: C1QT1_HUMAN
More Information
SKU ASBPP-374-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-374-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 114897
Product information (PDF)
×
MSDS (PDF)
×