Recombinant Human C4B Protein

Recombinant Human C4B Protein
SKU
ASBPP-4295-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P0C0L5

Gene Name: C4B,C4B_2

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Leu1331

End Site: Asp1430

Coverage: 0.06

Isoelectric Point: 4.5

Core Sequence: LSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 82%, Pig - 81%, Cynomolgus monkey - 96%

Alternative gene names: CO4; CPAMD3

Alternative protein names: Complement C4-B; Basic complement C4; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3) [Cleaved into: Complement C4 beta chain; Complement C4-B alpha chain; C4a anaphylatoxin; C4b-B; C4d-B; Complement C4 gamma chain]

Protein name: complement C4B (Chido/Rodgers blood group),complement component 4B (Chido/Rodgers blood group), copy 2

Full length: 1744 amino acids

Entry name: CO4B_HUMAN
More Information
SKU ASBPP-4295-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4295-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 721
Product information (PDF)
×
MSDS (PDF)
×