Recombinant Human CA3 Protein

Recombinant Human CA3 Protein
SKU
ASBPP-3693-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P07451

Gene Name: CA3

Expression System: Escherichia coli

Molecular Weight: 30.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Ala2

End Site: Lys260

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: AKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 86%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Carbonic anhydrase 3; Carbonate dehydratase III; Carbonic anhydrase III; CA-III

Protein name: carbonic anhydrase 3

Full length: 260 amino acids

Entry name: CAH3_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3693-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3693-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 761
Product information (PDF)
×
MSDS (PDF)
×