Recombinant Human CACNA1G Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O43497

Gene Name: CACNA1G

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Arg1161

End Site: Ile1240

Coverage: 0.03

Isoelectric Point: 7

Core Sequence: RGSLEREAKSSFDLPDTLQVPGLHRTASGRGSASEHQDCNGKSASGRLARALRPDDPPLDGDDADDEGNLSKGERVRAWI

Homologies: Highest protein sequence identity to the following orthologs: Rat - 90%, Pig - 88%, Cynomolgus monkey - 89%

Alternative gene names: KIAA1123

Alternative protein names: Voltage-dependent T-type calcium channel subunit alpha-1G; Cav3.1c; NBR13; Voltage-gated calcium channel subunit alpha Cav3.1

Protein name: calcium voltage-gated channel subunit alpha1 G

Full length: 2377 amino acids

Entry name: CAC1G_HUMAN

• SKU: ASBPP-4324-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4324-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 8913