Recombinant Human CACNA1S Protein

Recombinant Human CACNA1S Protein
SKU
ASBPP-4240-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q13698

Gene Name: CACNA1S

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Pro1511

End Site: Asn1660

Coverage: 0.08

Isoelectric Point: 4.5

Core Sequence: PPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDIVQIQAGLRTIEEEAAPEICRTVSGDLAAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNSLPPVMANQRPLQFAEIEMEEMESPVFLEDFPQDPRTNPLARAN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 93%, Pig - 93%, Cynomolgus monkey - 97%

Alternative gene names: CACH1; CACN1; CACNL1A3

Alternative protein names: Voltage-dependent L-type calcium channel subunit alpha-1S; Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle; Voltage-gated calcium channel subunit alpha Cav1.1

Protein name: calcium voltage-gated channel subunit alpha1 S

Full length: 1873 amino acids

Entry name: CAC1S_HUMAN
More Information
SKU ASBPP-4240-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4240-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 779
Product information (PDF)
×
MSDS (PDF)
×