Recombinant Human CADM3 Protein

Recombinant Human CADM3 Protein
SKU
ASBPP-3011-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8N126

Gene Name: CADM3

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Gln131

End Site: Asp220

Coverage: 0.26

Isoelectric Point: 6.5

Core Sequence: QKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGAD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 91%, Pig - 95%

Alternative gene names: IGSF4B; NECL1; SYNCAM3; TSLL1

Alternative protein names: Cell adhesion molecule 3; Brain immunoglobulin receptor; Immunoglobulin superfamily member 4B; IgSF4B; Nectin-like protein 1; NECL-1; Synaptic cell adhesion molecule 3; SynCAM3; TSLC1-like protein 1; TSLL1

Protein name: cell adhesion molecule 3

Full length: 398 amino acids

Entry name: CADM3_HUMAN
More Information
SKU ASBPP-3011-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3011-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 57863
Product information (PDF)
×
MSDS (PDF)
×