Recombinant Human Calpain 1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P07384

Gene Name: CAPN1

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Phe501

End Site: Leu580

Coverage: 0.11

Isoelectric Point: 5

Core Sequence: FEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSEEEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 87%, Pig - 94%, Cynomolgus monkey - 99%

Alternative gene names: CANPL1

Alternative protein names: Calpain-1 catalytic subunit; Calcium-activated neutral proteinase 1; CANP 1; Calpain mu-type; Calpain-1 large subunit; Cell proliferation-inducing gene 30 protein; Micromolar-calpain; muCANP

Protein name: calpain 1

Full length: 714 amino acids

Entry name: CAN1_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4293-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4293-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 823