Recombinant Human CBR1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P16152

Gene Name: CBR1

Expression System: Escherichia coli

Molecular Weight: 31.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Met1

End Site: Trp277

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Rat - 86%, Pig - 90%, Cynomolgus monkey - 96%

Alternative gene names: CBR; CRN; SDR21C1

Alternative protein names: Carbonyl reductase [NADPH] 1; 15-hydroxyprostaglandin dehydrogenase [NADP(+]; 20-beta-hydroxysteroid dehydrogenase; Alcohol dehydrogenase [NAD(P)+] CBR1; NADPH-dependent carbonyl reductase 1; Prostaglandin 9-ketoreductase; PG-9-KR; Prostaglandin-E(2) 9-reductase; Short chain dehydrogenase/reductase family 21C member 1

Protein name: carbonyl reductase 1

Full length: 277 amino acids

Entry name: CBR1_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3867-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3867-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 873