Recombinant Human CCL1 Protein

Recombinant Human CCL1 Protein
SKU
ASBPP-3160-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P22362

Gene Name: CCL1

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 38%

Start Site: Lys24

End Site: Lys96

Coverage: 1.00

Isoelectric Point: 9

Core Sequence: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 38%, Rat - 44%, Pig - 48%, Cynomolgus monkey - 78%

Alternative gene names: SCYA1

Alternative protein names: C-C motif chemokine 1; Small-inducible cytokine A1; T lymphocyte-secreted protein I-309

Protein name: C-C motif chemokine ligand 1

Full length: 96 amino acids

Entry name: CCL1_HUMAN

Product panel: Cytokines
More Information
SKU ASBPP-3160-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3160-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 6346
Product information (PDF)
×
MSDS (PDF)
×