Recombinant Human CD40 Protein

Recombinant Human CD40 Protein
SKU
ASBPP-3006-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P25942

Gene Name: CD40

Expression System: Escherichia coli

Molecular Weight: 31.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 59%

Start Site: Tyr31

End Site: Asp190

Coverage: 0.67

Isoelectric Point: 5

Core Sequence: YLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 59%, Rat - 36%, Pig - 76%

Alternative gene names: TNFRSF5

Alternative protein names: Tumor necrosis factor receptor superfamily member 5; B-cell surface antigen CD40; Bp50; CD40L receptor; CDw40; CD antigen CD40

Protein name: CD40 molecule

Full length: 277 amino acids

Entry name: TNR5_HUMAN

CD Antigen: CD40

Product panel: Neurodegenerative Diseases Marker,Neuroscience Biomarkers,CD Antigen
More Information
SKU ASBPP-3006-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3006-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 958
Product information (PDF)
×
MSDS (PDF)
×