Recombinant Human CD7 Protein

Recombinant Human CD7 Protein
SKU
ASBPP-3802-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P09564

Gene Name: CD7

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 50%

Start Site: Gln31

End Site: Pro180

Coverage: 0.72

Isoelectric Point: 6

Core Sequence: QSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 50%, Rat - 34%, Pig - 52%, Cynomolgus monkey - 85%

Alternative gene names: /

Alternative protein names: T-cell antigen CD7; GP40; T-cell leukemia antigen; T-cell surface antigen Leu-9; TP41; CD antigen CD7

Protein name: CD7 molecule

Full length: 240 amino acids

Entry name: CD7_HUMAN

CD Antigen: CD7

Product panel: IHC Pathology,CD Antigen
More Information
SKU ASBPP-3802-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3802-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 924
Product information (PDF)
×
MSDS (PDF)
×