Recombinant Human CD70 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P32970

Gene Name: CD70

Expression System: Escherichia coli

Molecular Weight: 29 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 66%

Start Site: Glu51

End Site: Trp190

Coverage: 0.77

Isoelectric Point: 7

Core Sequence: ESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 66%, Pig - 71%, Cynomolgus monkey - 96%

Alternative gene names: CD27L; CD27LG; TNFSF7

Alternative protein names: CD70 antigen; CD27 ligand; CD27-L; Tumor necrosis factor ligand superfamily member 7; CD antigen CD70

Protein name: CD70 molecule

Full length: 193 amino acids

Entry name: CD70_HUMAN

CD Antigen: CD70

Product panel: Cytokines,CD Antigen

• SKU: ASBPP-3801-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3801-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 970