Recombinant Human CDH10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6N8

Gene Name: CDH10

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Glu641

End Site: Gln760

Coverage: 0.17

Isoelectric Point: 4.5

Core Sequence: EPLILSKEDIRDNIVSYNDEGGGEEDTQAFDIGTLRNPAAIEEKKLRRDIIPETLFIPRRTPTAPDNTDVRDFINERLKEHDLDPTAPPYDSLATYAYEGNDSIAESLSSLESGTTEGDQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 77%

Alternative gene names: /

Alternative protein names: Cadherin-10; T2-cadherin

Protein name: cadherin 10

Full length: 788 amino acids

Entry name: CAD10_HUMAN

• SKU: ASBPP-2998-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2998-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 1008