Recombinant Human CDR2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q01850

Gene Name: CDR2

Expression System: Escherichia coli

Molecular Weight: 31.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Asp191

End Site: Leu450

Coverage: 0.58

Isoelectric Point: 6.5

Core Sequence: DEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Pig - 88%, Cynomolgus monkey - 99%

Alternative gene names: PCD17

Alternative protein names: Cerebellar degeneration-related protein 2; Major Yo paraneoplastic antigen; Paraneoplastic cerebellar degeneration-associated antigen

Protein name: cerebellar degeneration related protein 2

Full length: 454 amino acids

Entry name: CDR2_HUMAN

Product panel: Autoimmune Disease

• SKU: ASBPP-370-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-370-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 1039