Recombinant Human CDR2 Protein

Recombinant Human CDR2 Protein
SKU
ASBPP-370-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q01850

Gene Name: CDR2

Expression System: Escherichia coli

Molecular Weight: 31.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Asp191

End Site: Leu450

Coverage: 0.58

Isoelectric Point: 6.5

Core Sequence: DEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Pig - 88%, Cynomolgus monkey - 99%

Alternative gene names: PCD17

Alternative protein names: Cerebellar degeneration-related protein 2; Major Yo paraneoplastic antigen; Paraneoplastic cerebellar degeneration-associated antigen

Protein name: cerebellar degeneration related protein 2

Full length: 454 amino acids

Entry name: CDR2_HUMAN

Product panel: Autoimmune Disease
More Information
SKU ASBPP-370-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-370-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 1039
Product information (PDF)
×
MSDS (PDF)
×