Recombinant Human CEBPE Protein

Recombinant Human CEBPE Protein
SKU
ASBPP-4048-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q15744

Gene Name: CEBPE

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Asn201

End Site: Ala270

Coverage: 0.28

Isoelectric Point: 11

Core Sequence: NKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 96%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: CCAAT/enhancer-binding protein epsilon; C/EBP epsilon

Protein name: CCAAT enhancer binding protein epsilon

Full length: 281 amino acids

Entry name: CEBPE_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-4048-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4048-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1053
Product information (PDF)
×
MSDS (PDF)
×