Recombinant Human CHMP2A Protein

Recombinant Human CHMP2A Protein
SKU
ASBPP-3844-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O43633

Gene Name: CHMP2A

Expression System: Escherichia coli

Molecular Weight: 26 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Asp222

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 27%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: BC2; CHMP2

Alternative protein names: Charged multivesicular body protein 2a; Chromatin-modifying protein 2a; CHMP2a; Putative breast adenocarcinoma marker BC-2; Vacuolar protein sorting-associated protein 2-1; Vps2-1; hVps2-1

Protein name: charged multivesicular body protein 2A

Full length: 222 amino acids

Entry name: CHM2A_HUMAN
More Information
SKU ASBPP-3844-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3844-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 27243
Product information (PDF)
×
MSDS (PDF)
×